dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|312113039|ref|YP_004010635.1| (Rhodomicrobium vannielii ATCC 17100)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment zinc-binding CMP/dCMP deaminase protein [Rhodomicrobium vannielii ATCC 17100]
Sequence length 157
Sequence
MQEALIEAERAAALGETPVGAVVVAPDGSIAGRGHNLVISVRDPFGHAEMRAIRQACEAV
QSERLPGYDLYVTLEPCTMCAAAISFARIRRLYFGAWDEKGGAVENGVRFFSAATCHHAP
EIYGGIAQAEAAALLRAFFQERRDERAQVNASRTPRD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]