dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|313679031|ref|YP_004056770.1| (Oceanithermus profundus DSM 14977)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Oceanithermus profundus DSM 14977]
Sequence length 226
Sequence
MKKFLALVALLFAIAWANPATLIDEGRFQQAYEEALAQGTATAYALAAKAASYYAGYVAS
TGKDKEAWFSKAEAAAKKAIAADPGYPEGYFELARAQGRLSQYRGILASLNLASSVRDNL
KKALELDPKHDSALVALALWNLELAQKGVGWMYGASIKRVEPLFQEAIALNPTAIAHRLE
YGGALIRLKKPERAREQLEKALELPARTWVDRADQEKARALLESLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]