dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|313680732|ref|YP_004058471.1| (Oceanithermus profundus DSM 14977)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment lytic transglycosylase [Oceanithermus profundus DSM 14977]
Sequence length 550
Sequence
MFRRLATLGLLFLAPVWAQLPAPYRAYEQARQAEDAGGLERLLAEPGYVQVLAARALSRM
AALSPSRRLELAERAARFENAAGDWLWVGRLREVLGDAPGAAEAYGKALPEPEAEAALVR
LARAGVRRAYAALYAGRAYEALLDALPAEGEAAWRARALAGLHRYAEALPHFRAWARDSR
EGRLALGRLLLELKRYAEAEAAFRDAGGAAGAFGRGRALEALGRSEAAVRAYLEARTPEA
LWRATALLERAGRAAEALPLYRELATGDSQYADDATLRLWVLARRRGDAALEAWAYARLD
GGLGLLAGRPYPRPPSGGAPPVAAAGAERAEALFAAGREAWAWGEARWWARRYRQEGRSE
QLAAVVAELERWGWWGRALRLLHGLPLRDGGGDLLRLAYPRAYPGIVEAEARAFGLEPEL
LWAVMRVESRFDPEAVSPTGAKGLMQFVAATWSDVARRLGEEGADPFDPEAAVRFGAYYL
RHLLDVCDRELVCALAGYNGGPGYTRRALAAEDGDVWDFLRFQPRDEPREYVERVLWAYQ
AYKALYRAAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]