dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|387132511|ref|YP_006298483.1| (Prevotella intermedia 17)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DNA mismatch repair protein MutS [Prevotella intermedia 17]
Sequence length 924
Sequence
MDKAQINWLSFAQYAENSYFCISRITTTKGKKGKNNMAKDNKGLTPMMRQFFSMKEKHPD
ALMLFRCGDFYETYCDDAIEASKILGITLTRRNNGAAAGDEMAGFPHHALDTFLPKLIRA
GKRVAICDQLEDPKKKREALKGKRGLSAEDKMVRRGITELVTPGVAMGDNVLNYKENNFL
AAVHFGKGSCGVSFLDISTGEFLTGEGTFDYVEKLIGNFSPKEVLYDRARKSDFERHFGT
RLCVYEMEDWVFTDLSARQKLLKHFGTKNLKGFGVDHLNNGVIAAGAIMQYLELTQHTNI
NHITSLARIEEEKYVRLDRFTIRSLELVAPMQEDGSSLLNVVDRTITPMGGRMLHRWLVF
PLKDVKPINERLDIVEYYFREPDFRQCLNDQLHRMGDLERIISKVAAGRVSPREVVQLKI
ALRAIQPMKTACLYANNEALKRVGEQLNLCESIRDRIEQEIKPDPPHLVAKGDVIAHGFN
AELDELRSIRDNGKQVLLDIQEKEAAQTGISSLKIGFNNVFGYYLEVRNTFKDKVPSDWI
RKQTLAQAERYITPELKEYEAKILGADEKILALEARLFNELVQDMQEFIPQIQINANLVA
RLDCLLAFANIAEENKYVRPVVDDSMVIDIKKGRHPVIETQLPLGEPYIPNDVYLDNEQQ
QIMMITGPNMAGKSALLRQTALIVLLAQIGCFVPAEGARIGLVDKVFTRVGASDNISLGE
STFMVEMTEASNILNNVTPRSLVLFDELGRGTSTYDGISIAWAIVEYLHEQPRAAARTLF
ATHYHELNEMAKNFRRIKNFNVSVKEVDGKIIFVRKLERGGSEHSFGIHVADIAGMPKSI
VKRANVVLKELEADNAQVGSVGKPSAEKLEQSREGVQLSFFQLDDPVLTQIRDEIIGLDI
NNLTPVEALNKLNEIKRIVLPNSK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]