dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|320100783|ref|YP_004176375.1| (Desulfurococcus mucosus DSM 2162)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 2'-5' RNA ligase [Desulfurococcus mucosus DSM 2162]
Sequence length 191
Sequence
MSSELVRSFIAIEVKNRDVLRRLIEARDRVAGVGVDLKPVEDENIHLTLRFIGEVPRSTV
EEVCGIVTGISFKPFEMHVKGIGGFPSLERPRVIWAGIEEGAGELLELYRVVEAGLRRLG
VKPEREEFTPHITLARVKGYRGLEKLVKVLLEMRDMDFGYTPVDEVIVKKSVLTPRGPIY
SNICVKKLVQQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]