dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|333906640|ref|YP_004480226.1| (Marinomonas posidonica IVIA-Po-181)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RpiR family transcriptional regulator [Marinomonas posidonica IVIA-Po-181]
Sequence length 289
Sequence
MKNTFSSKPEHIATTTSQRIQELIPLVSKSEARVAQFILLNLDHISYETGASIAEKAAVS
QITVSRFLKRAGYQGISALKEELQKELIPIEANESQRLAPDSFYKDNLKQELKSMVRLYE
QFETENWESLVSCVSAATRVYVTGFQSIRGTAEDFTRRLSLARDRVQYLSPHDGMLGEWL
EDSSRSRKGYDTLIILDVVPYASEVRKLCEVAVEKGIQIVIISDEFCHWASEYDAHIVYS
KSKSGLFLESTWGLVLTTNMLVDAVSRRDVNSDTRIKRWQEMAKRLDLF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]