dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|333906701|ref|YP_004480287.1| (Marinomonas posidonica IVIA-Po-181)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glucose-6-phosphate isomerase [Marinomonas posidonica IVIA-Po-181]
Sequence length 548
Sequence
MRSPTEFSAWKKLAEHQQEMISVDMTSLFQADPKRADKYQAQAAGWTLDYAKNRANDTTL
SLLTELANEAGMKNAIDGMFSGAHINNTEDRSVLHVALRASQAQDTLMVDGVNVLAEVRA
TLKQMEQFVAQLHTGEWQGYTGKAITDVVSIGIGGSYLGPKVVAEALTPYKKDSIKVHFV
ANIDGSDITGKLKQLNPETTLFVISSKTFGTLETLSNANAARDWFLSNGGSQDNVSKHFA
AVSSNVKKAVDFGMAKENIFPMWDWVGGRYSLWSAIGLPVAIAVGMDNFYELLDGAHQMD
EHFRTAPLEENLPVIMGVLGVWYINFHNAQTHALIPYDHYLRAMPAHIQQLDMESNGKAN
LLNGDAVETDTGPIIWGGAGTNGQHAYHQLLHQGTRLVPVDFIAPLTSHNPIAEHHTHLF
ANCLSQSQALMVGKTLEQAQQELKDAGATDEQVAKIAPHKVIKGNRPSNTLLTDKMTPAS
VGALIALYEHRTFVQGTIWGINSFDQWGVELGKVLGTDIYNRLVSNSDNSALDASTQALI
KAFKKAQH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]