dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428222207|ref|YP_007106377.1| (Synechococcus sp. PCC 7502)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment argininosuccinate lyase [Synechococcus sp. PCC 7502]
Sequence length 461
Sequence
MTNTPQPWSQRFETALHPAIARFNASISFDIALIEYDITGSQAHAKMLGQVGIISESEAE
AIVTGLEQIRQAYRSGEFIPGVEAEDVHFAVEKRLTELIGDTGKKLHTARSRNDQVATDV
RLYLREQINLIKSDLRNWQAAIVTQAEQNIDTLIPGYTHLQRAQPVSLAHHLLAYFEMAQ
RDYQRLGEIYNRVNVCPLGSGALAGTPHPINRALSAEYLNFGAVGNNSLDGVSDRDFAVE
FLNAASLIMVHLSRFSEEIILWSSQEFSFIGLSDRISTGSSIMPQKKNPDVPELVRGKTG
RVFGHLQGMLTLLKGLPLAYNKDMQEDKEAIFDTVTTVRVCLEAMTILLTEGITFKKDRL
AQAVTEDFSNATDVADYLATKGVPFREAYNLVGKLVKTCTSEGILLKDLSLAQWQEFHPK
FESDIVEAIAPTQVVNVRNSYGGTGFEQVKLQVATAKTVIS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]