dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|333898947|ref|YP_004472820.1| (Pseudomonas fulva 12-X)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GCN5-related N-acetyltransferase [Pseudomonas fulva 12-X]
Sequence length 151
Sequence
MRIVQATLEHLDLLTPLFVRYREFYGERPFPDSSRKFLETRLKRDESVIYLALADDDNKL
LGFCQLYPSYSSLSLKRVWILNDIFVAEDARRQLVADRLLQTAKKMAKQTQAVRMRVATS
RDNEVAQKVYESIGFVEDEQFKNYVLPINSE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]