dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|328544289|ref|YP_004304398.1| (Polymorphum gilvum SL003B-26A1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MetF-like protein [Polymorphum gilvum SL003B-26A1]
Sequence length 300
Sequence
MTEIRSRTIDEVQSACAPLRGPLWLAPWSLEATAPTAADIAALAPLVPPGTDVLLSALPR
IPHDEQIAAARLVRAAGLEPVLHLSARKFASEAELGHLLETACRDIGLRKVLVIAGDIDA
ARGPFASSLDLIESAPFRAAPLQSVGIGGYPEGHPFVADADLERSLRSRLDAIRDAGRAP
FLVSQFCFDAERILRWLDGLRRLEPALPVRIGLAGPASAATLMKVALRCWVDLPMRHART
ATRLLSSGTPDPIVAGLDAGLRPHHRSGPLQIHVYGFGGLVKAAAWAGEAARTARAGWTA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]