dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|328545457|ref|YP_004305566.1| (Polymorphum gilvum SL003B-26A1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Betaine-aldehyde dehydrogenase [Polymorphum gilvum SL003B-26A1]
Sequence length 475
Sequence
METHMLIGSAFEAGTETEETILNPKTGAAVLNLAEASAAQIDRAVDAADRAFATWSQTTP
AERSGYLLKIAERIEAEADGFAALEALNCGKPINAVKNDELPAIIDCYRFFAGAVRCIPG
SAAGEYMKGFTSMIRRDPIGIVASIAPWNYPLMMMAWKLAPAIAGGNTVVFKPSEQTPLT
ALKMARILADVLPEGVVNVVLGRGESVGNALINHPKVNMVSITGDVATGKKVLQAAAKSV
KRTHLELGGKAPVIVFDDADIDAVVNGLRAFGYYNAGQDCTAACRIYAGPKIYEKLVADL
SSAVSTIAFAREDDSENEIGPLISQRQRDRVASFVERALQQNHMEATAGGKAHDGNGFFF
QPTVIAGALQSDEIVRREVFGPVVSVTRFSDVDEAVAWANDSDYGLASSVWTKDVSRAMA
TAARLRYGCTWINTHFMLVNEMPHGGLKQSGYGKDMSLYALEDYTAVRHVMVAHG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]