dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|53712166|ref|YP_098158.1| (Bacteroides fragilis YCH46)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 1-deoxy-D-xylulose 5-phosphate synthase [Bacteroides fragilis YCH46]
Sequence length 648
Sequence
MKNEPTYSLLNAINYPKDLRQLSVDQLPEVCEELRQDIIKELSCNPGHFAASLGVVELTV
ALHYVYNTPYDRIVWDVGHQAYGHKILTGRREAFSTNRKLGGIRPFPSPEESEYDTFTCG
HASNSISAALGMAVAAERKGEKDRHVVAVIGDGSMSGGLAFEGLNNASSTANNLLIILND
NDMAIDRSVGGMKQYLFNLTTSNRYNQLRFKTSRLLFKMGLLNEERRKALIRLGNSLKSL
AAQQQNIFEGMNIRYFGPIDGHDVKNIARILHDIKDMQGPKILHLHTIKGKGFGPAEKQA
TIWHAPGKFDPVTGKRIVANTDGMPPLFQDVFGHTLVELAEKNKRIMGVTPAMPSGCSMN
MLMDRMPDRAFDVGIAEGHAVTFSGGMAKDGLLPFCNIYSSFMQRAYDNIIHDVAIQKLN
VVFCLDRAGLVGEDGPTHHGVFDMAYLRPIPNLTISSPMDEHELRRLMYTAQLPDKGPFA
IRYPRGRGSLVDWECPLEEIPVGKGRKLKDGNDLAVITIGPIGKLAARAIERAEADTGIS
VAHYDLRFLKPLDEELLHEVGKKFRHIVTIEDGIIKGGMGCAILEFMADNGYYPEIRRIG
VPDQFIEHGSVQQLYHLCGMDEEGIYKVITKNKLRMDAPVESCMATHS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]