dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|218884266|ref|YP_002428648.1| (Desulfurococcus kamchatkensis 1221n)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NADH-quinone oxidoreductase subunit B [Desulfurococcus kamchatkensis 1221n]
Sequence length 337
Sequence
MLERIARWAYARSLWMIHYCSACGAVEFPPLVMAPLDWERYGYMPTPSPRQSDLYIGMGY
LTKKTVKLVLNMYRQMPEPKLVLAGCNCTSTGGPYWDSYATYKRLDDFIEVEGWVPGCMP
MPDDYLSMIEYVRKDLGKRPLNAYVSKIKPDAFKKISEWEELEKQWRKEYEEKIKEDSSK
PVSYEFKETYPSCYEKDEKSKICKTSVNPEKIRDALMDLKNKGHVLFVNINTVDYPDKGV
IEVYYVLENPSDGSQVWVKTYAKRASPEIDSVHDIFPLAKYIEREVYEFMGVVFRNNPEL
KKWILDGNWEGPPPLRKDVDTAGFVMKTMYGGYKYGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]