dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PCAS_020970 (Plasmodium chabaudi )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PCAS_020970 cysteine desulfurase, putative 904921:906561 reverse MW:62074
Sequence length 546
Sequence
MKVFKIAKTLNPQSSNIFNKLNKCSETACFKNNLKHNYTSVVNSNENVFNKNGCHNHRKF
NSKADNDEVTTEGEGNEIKMKIPKSSENLKNDTPNDNLDILNTINNALNDQKNNDNFNKL
NKKIELIANFMSKEKEKKMNRFYLDSQATTMIDPRVLDKMMPYMTYIYGNAHSRNHFFGW
ESEQAVEDARANIIKLLNGTNNKEIIFTSGATESNNLALIGTCTYYNKLNNKKNHIITSQ
IEHKCILQTCRYLQTKGFEVTYLKPDTNGLIKLEDFKNCIKENTILASFIYVNNEIGVIQ
DIENIGKICKENNIIFHTDASQAVGKIQIDVQKMNIDLLSLSSHKLYGPKGVGALYIKRK
KPNIRLNAIIHGGGQERGLRSGTLPTHLVVGLGEAANICLSEMDRDNQKMHFFFNYVKNY
ISKNLDYIVFNGCQTNRYFGNMNISFLFVEGESLLMSLNDIALSSGSACTSSTLEPSYVL
RSIGITEEIAHTSIRIGFNRFTTFFEVQQLCNNLVKSVKRLRSISPLYEAELEKNTSGDY
PKFIWT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]