dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PCAS_132310 (Plasmodium chabaudi )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PCAS_132310 serine hydroxymethyltransferase, putative 14174624:14176078 reverse MW:57289
Sequence length 484
Sequence
MKIVKELCKKGKVKWRRYISSQSLQNYNSLKNVDEDNYNILSTYKNKSYLNLSVCNNVIP
KYVHDCLVNNLNKNVTLNLEHLKIIEDRALAAFNLENKYWGCVFNTSSHSECTNSMDEYF
LLKLFRNFVNYQSKIMIISFTLLDKETHEENNKEENRTDKNVLNEFYNILYIKNNDKINY
MEIKNQYEQFKPDLIYIDETNNPYNFDYEFITTLRNMKSKINNNVNSEKEGVEDKSNTLV
MTNISNKASFIIEKFISSPFSQADIVFSYLNENIRANNCYIIFYRKGFKNISTQGKLICY
EYEEKLKKTFFQNNVNNIICSLSTSFKCIQNHEFKEYIHQINKNINVLFSYLNKKYFNIH
FDQNNNFLNIACSNSLFNIQEYHMFCKKINILFDIININKSIYPQKSFNIGTNYLTALGM
EEHDMKYVSEFINQSILLYLYTKQKSANSNLTFLEYLENNFISSDILALSNDIHSFVSMF
PSPS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]