dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PCAS_146150 (Plasmodium chabaudi )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PCAS_146150 delta-aminolevulinic acid synthetase, putative 18131506:18133564 forward MW:72624
Sequence length 627
Sequence
MRKKKALKVSLDEIKKYCPFVKNIKIFYENHEKKNNVVLSVMSNLCPIGKAINKKHLIVI
DNKSKINIFKILRGHNLCSRQNVEECIKKNNVIIEGKCKHLETENNDLYLYEHEIKNNNS
CNENAILEILKSPYNIFQNECNNDLKELINKLFIDKRYRIFTILNKLRKIYPNVYIENNK
LLLSSFYEFYQKFGYKLCIGASPYNIKRVLDCSTIKLDYTMDKIKEISHENNSVNKLKDI
CNINLNDFRKRGITNDKTVIWCSNDYLSLSNNEQVIDVGIETLKKIGNSSGGTRNISGSL
LNHTHLEYILARWFNKESALLFTSGYIANMGALGTLGKLLNLVFVSDQMNHASIINGIQE
SRCEKYIFKHNDMTDLENVLKRLRMKKEYKNRKIMIVFESIYSMSGNISDIKKIVQLAKK
YNALTYIDEVHAVGLYGKTGSGYSEELNLCDEIDIINGTLSKAIGSLGGFICANKYYIDV
IRSYSPHFIFTTSLTPVNITTSAEAIYIIQNDMELRNRFRHVVNRTKEKLKERGILIIDN
DSHIVVTLINCPQKCKQICDDLLTMYNIYLQPINYPTVPKGSERIRITPSPYHTEEQISK
LADSLYTLFKKYEVNMFNKKNKIEMRL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]