dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|319786467|ref|YP_004145942.1| (Pseudoxanthomonas suwonensis 11-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD [Pseudoxanthomonas suwonensis 11-1]
Sequence length 1558
Sequence
MAVIRANRESIDDRFNVLGFTVRSELPLFEIALASEPELLHPSQRGRRTPGNFFTSRLMR
VQPSPHGEAVYLVPPDVVARFVGQQRLYFGLATYRDGDRSTPVSLRLPDRGSLYVSLAGL
TGRGLRRTVRGHAGNGYGGSGAELGWGGDNLDATPAPGEEPARRATNGSGATADSGYSDG
YSDELWNAPPAQPEPAAAAAPQPPASESAPAPAPTAQGLAARQRAGARALLVEPYYQPED
WWEALTTQIAHFARGAMWFLGVADTTRPPYSAICQVRVPDGSEEGSHHGTAFFIAPRLLL
TAAHVVDGQAELIIVPGKNGAGTGAASEPFGRFRASVFRKHPRYGSDGHGNDMALIQVPA
ANAAAAPNYFGLVEELNQSRPEGVVVSGYAAWWHAVSAIEHFVNANIDENRQHAHGGHIR
ELVGEGTFTYDLQTLAGTSGSPVYWIESGQHPVAHLVGVHVAANDNRTNAGCRITQEKLA
WIRSVAAEWGQALGFALGAGGGSRAARALGADGHDDGAYDIGGPIPDAPAAAAQDWRAAR
GLSLSAPEYPQASRFEPAHPGNYRSVPGSRSIERIVIHITDGGPNIAGPVSWFKNPDARV
SAHYIVGQDGEVVQMVAHKDVAWHAGSANSSSIGIEHVANTRGLLPTPQQLAASAALVGW
LCQQYGIPVDRDHILGHAEADTRTTHRGCPNAVWDWDYYMGLVTSRSSYMPTAQGLRSHA
RALEVIQPYYDPSDPHRALACTADAMSREFEEWFVGIDDTRRFPHSAICMLEITGNDGYL
YRGTGFYIGRNRILTCAHNLDDCSQVKISPGLNGAGNAPFGSATVPASSWRIAPGYAGTG
DWANDLAVIENVPIAAPHGLWFEFLQATPAGSMRLAVCGYSSQSDAIPGLTDLIDSHKQH
LHGGTGAYQASLETIDYPILSLRGASGSPVYAVSNEGGTLKAKVCAVHVSGQPADTDNVN
RGCFITPRKIDWIEGRASSFALGAPSRALQAFSVHWTDVPMNYQSSPMSCWAAAASMVAG
WRDQASIPDSEIAAKVPVFDAFNRGLYGHERGYLADAWNLYAEPPASYTVDAWRQMLEAK
GPLYIAQISAAGASSGHVRVLVGMDSDGAPDGSGTTMYLHDPALGPIRQSFAEFVALYEE
RVVTGGEHYQMQVLHSGGAAGRRPGSAAAFALGVHSRAQENDGPSDYPVHLIPQPDKNAC
WAASMAMLLSYRRSQSIAPETIVQEVGGSLATSYGWDLLEAVKSRYGFRTIEMPSNASLY
HAPRQWAQWLQAHGPLWVVIVGAPHAVVVAGIRGNLDDPGATQVKVLNPWDVRVAFDQDP
IAFNPPNNGYEDWIDFSEFASDFGEMAESDYGNWRVLHLPAASAGAQSLSARGGLRLAAP
PPRVVVALETQVGERREPIEPSRVAGTTMARVVGEAGACRWRLDQLEGMKAPATLLPGLS
PATPGDTRIALDDWPAFEASPTPLPLTVEFRHDGAAVGDVRVTAGSPANLAYGVEVAARI
EDCADADGVARLRVRIDYRFHGLAQGNPDATVELALRGDGRYERENGWRNVEQLTSAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]