dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|332669721|ref|YP_004452729.1| (Cellulomonas fimi ATCC 484)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ADP-ribosylation/Crystallin J1 [Cellulomonas fimi ATCC 484]
Sequence length 343
Sequence
MLRPVGPWPGHRHTPPATDGDPPVDDAQTALLDRAAGVLLAQAVGDALGVPYEFAPPFDG
PARMVGGGLGPYAPGEWSDDTQMSVCVARVAATGTDLTSDAALDAVADGFLAWLTGGASD
VGAQTRQVLTTETPGPGSAANLRARSAQLHDLTGRTAGNGALMRTGVVGLTALHDRERTA
AAARAVALLTHADDLAGDSCVLWSEAVRVAVLDARLDLLGGLDLLPPDRRDAWQTRIEDA
TGADPALFAPNGFTVTALQAAWAAITTTTAHDGTRHLPDALQAAVHAGDDTDTVAAIAGA
LLGARWGASAVPSDWRTAVHGWPGLTGEDLVDLGRRAARAGCA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]