dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|331695199|ref|YP_004331438.1| (Pseudonocardia dioxanivorans CB1190)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GntR family transcriptional regulator [Pseudonocardia dioxanivorans CB1190]
Sequence length 262
Sequence
MSGDTAEIDAARGRAGEIDAARGRAGENDAARGRAGEIVEALQRRILMGEVPVGSWLRHE
ALAAEFGTSRTPVREALRILDAQGVVTIVRNRGARVDGHSGRDLRELGEVRAELEGFAAQ
LAAERIDDAQLERLRGAWHGFRRAIEEFVDLPAAERTVRTAPAWVEANGRFHVLVAEASG
NRQLAHTIADIHRRLPQNISFAAYAGRVRLLRRNLAEHDEITDAIARGDGVSARAAMTAH
IRNAVEATSRWAEDNGLVRERY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]