dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|319899060|ref|YP_004159153.1| (Bartonella clarridgeiae 73)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L11 [Bartonella clarridgeiae 73]
Sequence length 142
Sequence
MAKKSVGQLKLQIPAGAATPSPPIGPALGQRGINIMEFCKAFNAATQEMEKGAPIPVIVT
YYQDKSFTFSLKTPPVSFFLKKAANLKSGSKEPGKVSVGTIPRDKIRSIAEAKMKDLNAN
DIEAAMRMVEGSARSMGLEVLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]