dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|334336292|ref|YP_004541444.1| (Isoptericola variabilis 225)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoribosylglycinamide formyltransferase [Isoptericola variabilis 225]
Sequence length 214
Sequence
MQTPSGHPVESTTQARLVVLASGGGSNLAALLAAHDDPAYGARVVGVVSDKPEAGALRLA
RDAGVASVVVAPADFEDRAAWNVGMAEAVAVFRPDYVVLAGFMRILAPSFVDRFAGRIVN
THPALLPSFPGAHGVRDALAYGVKVTGCTVHVVDTGVDTGPIIAQAAVPVVDGDDEASLH
ERIKVAERALLVETVGRVAREGLRVDGRRAVVGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]