dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386014109|ref|YP_005932386.1| (Pseudomonas putida BIRD-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein PPUBIRD1_4620 [Pseudomonas putida BIRD-1]
Sequence length 145
Sequence
MEMQWWIWLVFGIALILLELVLPTFFILWFGIGAVLVSLISLAAPSLQLDMQVLLWVLLS
SATTVLWFKVFRRKQPDVRWTADSVIGEVGLLTAPVSEFQKGRVRFQKPILGNEEWTCVA
DSQIAVGERVRLTAIEGNTARVIRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]