dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0144760 (Drosophila grimshawi 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_15252:complement(232585..233552,233610..234258); ID=FBpp0144760; name=DgriGH10854-PA; parent=FBgn0118335,FBtr0146268; dbxref=GB_protein:EDW02770,FlyBase:FBpp0144760,FlyBase_Annotation_IDs:GH10854-PA,REFSEQ:XP_001987903,FlyMine:FBpp0144760; MD5=9cc95a79959fc42a05047263f64a9064; length=538; release=r1.3; species=Dgri;
Sequence length 538
Sequence
MTAQRRTLVHWFRKGLRVHDNPALFQIFEVARAAPEKFYVRPIFILDPGILDWMQVGANR
WRFLQQSLSDLDQQLRALNTRLFVVRGKPVDIFPGLFERWQVQLLTYETDIEPYAVLRDA
AVQQLAASQGVKVDTHCSHTIYNPELVIVRNLGKPPITYQKFLGIVEKLKLPKVLNKPKK
LPDGMQPLADSDIYDYPTLEQLVKRPEDLGINKFPGGESEALRRMEASLADEQWVAKFEK
PKTAPNSLEPSTTVLSPYLKFGCLSARLFHERLQEILARQPKHSKPPVSLVGQLLWREFY
YTVAAAEPNFDRMLGNAYCLQIPWQEQPEHLEAWAHGRTGYPFIDAIMRQLRQEGWIHHL
ARHAVACFLTRGDLWISWEEGQRVFEQLLLDQDWALNAGNWMWLSASAFFHQYFRVYSPV
AFGKKTDPKGDYIKKYVPELAKYPAKCIYEPWKATLGEQRDYGCVLGSDYPHRIVNHDVV
HKENIKRMSDAYKVNREVRTGKQEEGHEEEEEYEEHPTGKRKASSKVTGSKLKHKLLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]