dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0148187 (Drosophila grimshawi 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_14830:complement(4004422..4005152,4005208..4005397,4005735..4005931,4008676..4009294); ID=FBpp0148187; name=DgriGH14281-PA; parent=FBgn0121757,FBtr0149695; dbxref=GB_protein:EDV91392,FlyBase:FBpp0148187,FlyBase_Annotation_IDs:GH14281-PA,REFSEQ:XP_001994763,FlyMine:FBpp0148187; MD5=21124762af76c93070ffb12fa8271ed6; length=578; release=r1.3; species=Dgri;
Sequence length 578
Sequence
MVHSAGCGFQGLDPLACCPPQQQGSSRNSRWVWDTPSSSKRSTRFNNDYNRFEAYETEMH
LHEYRDFNSQLNCPQPLDEEYDDDHHLHHQQFGFPGHHYHYHVDHEVKPRPKPANRPIVF
PGDLRFHHSIETKGNGKLMADDSQEQAMPEDSTTTTAASTTSTAAPPAVRMNDPDCGISL
TTRISGGQQVVPGQYPWLARIAYRNRKLYFPNEATQVSNYGRCITPNRERALCIHLEDCK
YLYGILTTSPLRNEDKLYLSRSQCGYYNRKVLICCPDRYRDSSPVTTARPPVNSTNTNLL
PQPGQCGNLLSNRIYGGVKTKIDEYPWMALIEYTKGGGNKGHHCGGSLINNRYVVTASHC
VNGKSLPADWRLTGVRLGEWDTTTDPDCETDIRGMKDCAPPHLDVPVERTIPHPSYDPGS
KNQINDIALLRLSRQIEYTDFVRPICLPLDTNLRSAAFDGISMDVSGWGKTEELSASNLK
LKAAVDGVTLEECQSVYGRQDIFLEDTQMCAGGMEGVDSCRGDSGGPLIGQNTNKVNTYY
FLAGVVSFGPTPCGLNGWPGVYSRVGAYVDWIQTSLKP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]