dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0154264 (Drosophila grimshawi 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_15245:complement(9595742..9595830,9595896..9596355,9596422..9596531,9596592..9596755,9596813..9597507); ID=FBpp0154264; name=DgriGH20358-PA; parent=FBgn0127821,FBtr0155772; dbxref=GB_protein:EDW01615,FlyBase:FBpp0154264,FlyBase_Annotation_IDs:GH20358-PA,REFSEQ:XP_001986748,FlyMine:FBpp0154264; MD5=da43b5edc881067f009c5651cb5a66d2; length=505; release=r1.3; species=Dgri;
Sequence length 505
Sequence
MLLKIRHALLEVTNQSAKQSIKQSAIIINNEIIISSSNILQPHIRLAGDGDKIIQSLQQC
KLVDAQDENCAQGKLLRTLHYLVTFDRQRRRLTDRSAQQNSTSHILTRYTAQPLYVFCAA
EVSRNLHKILMNADSDEQNVLRSSFLVLTMRELKERESFKRFLQHIASYLRYLQPIHTLD
DVLVMCSPFGLENFYKTISIGKVSNVMGASLFGLSNALPLGCEGAAVFNNNLRLIGIIIC
TSFQRDQENVNLTLAANFGYLLRDFIAQLGTPISMLNLPREPSNFAWERTIVVIGSAGQQ
GTGTFIKVYNKRFILTCAHVVGQPNSQVHCRAIDQEFKSDVIWCNPDESRPYDLALLTAP
ENIPEHHCVRMSRNRATLGQTVYNAGFPYYVNFNFKYDFNPSIFQGRIIKCDQGAIMSDG
SVQAGQSGGPMFDQNGSILGVCVSNIKHEDIVYPNINTAIPTFDIRQTLQEFAKTSDIKV
LNNLVANQDVCRVWSLEMPLIQSKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]