dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0130838 (Drosophila erecta 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_4820:join(7161620..7161656,7161718..7161984,7162067..7162200,7162262..7162411); ID=FBpp0130838; name=Dere\GG12292-PA; parent=FBgn0104583,FBtr0132346; dbxref=FlyBase:FBpp0130838,FlyBase_Annotation_IDs:GG12292-PA,GB_protein:EDV53751,REFSEQ:XP_001981881,FlyMine:FBpp0130838; MD5=21613c0e0b508ac1f8d53a3e6ef9e63d; length=195; release=r1.3; species=Dere;
Sequence length 195
Sequence
MADNAEPLTLSKDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYET
VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE
MEMRFDKQRNTRRRQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]