dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

FBpp0130943 (Drosophila erecta 1.3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment type=protein; loc=scaffold_4820:join(8342695..8342766,8342847..8343095); ID=FBpp0130943; name=Dere\GG12397-PA; parent=FBgn0104685,FBtr0132451; dbxref=FlyBase:FBpp0130943,FlyBase_Annotation_IDs:GG12397-PA,GB_protein:EDV53955,REFSEQ:XP_001982085; MD5=2d74e942a91431168af6b0268105de76; length=106; release=r1.3; species=Dere;
Sequence length 106
Sequence
MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKA
GKLNTYRFCDNVWTLMLNDVEFREVHEFVKVDKVKIVACDGKSGEF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]