dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|339489153|ref|YP_004703681.1| (Pseudomonas putida S16)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment TetR family transcriptional regulator [Pseudomonas putida S16]
Sequence length 210
Sequence
MVRRTKEEAQETRAQIIEAAEKAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQ
ALLDSLHETHDHLARASESEDEVDPLGCMRKLLLQVFNELVLDARTRRINEILHHKCEFT
DDMCEIRQQRQAAVLDCHKGITLALANAVRRGQLPGELDVERAAVAMFAYVDGLIGRWLL
LPDSVDLLKDVEKWVDTGLDMLRLSPALRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]