dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|392422476|ref|YP_006459080.1| (Pseudomonas stutzeri CCUG 29243)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ferredoxin:oxidoreductase FAD/NAD(P)-binding subunit [Pseudomonas stutzeri CCUG 29243]
Sequence length 529
Sequence
MAAFNRFRLFHWLLAGFFLGAYLSGDDAETLHIWLGYGLVALLMWRLLIVPLRLRGFPQL
LPPKGQRSKPGLSSVGKWLTVGALGSFAIASVVGLGMVDNGDVLAALPGVGPDVFGAASD
IEFVGWMGDAEEVHEFFANLGLWLIGLHVGYVLLFRRKAVWPMLRGVPKSGPASTAPSTS
APVATSLALSPSPVEGEFTRLRIVSRQAETADSCSFTLQVPAAQRVRFTTQPGQFLTLKV
PGAEPALLRCYSLSQRPQADGALRITIKRVPGGRASNWLLDNLQAGDCIEALPPSGVFVP
RSLEGDLLLLGAGSGITPLMAILQAALVEGSGRVFLFYASRDAASLIFAEELAEWSARYP
ERLQLRIWLDAEQGVPNAAAIAAKLAGWPLAEAFVCGPQPFMDGASVALGELGVVAARIH
LERFGAAAPRGEAGRETGGRRSRLRVALDGRRHELDVPRGEVLLEAMEQAGLQPPSACRS
GVCAACKCRVVEGSVSMRSNQVLSESEVRQGWALACQAEPRSAELQVEY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]