dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSCPOP00000009313 (Cavia porcellus 76_3)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:20772126:20774852:1 gene:ENSCPOG00000010367 transcript:ENSCPOT00000010461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 370
Sequence
MEPRRVTPGKPCRGPRVATGSRTAAELVYHLAGALGTELQELARRFGPEAAAGLVPLVVR
ALELLEQAAVGPAPDSLQVSAQQAEVELRRLREENEHLRREARAGPQEERALLLRLKEVT
DKQRDELRAHSRDLRQRSQETEALQEQLQRLLLVNAELRHKLAAVQAQLRAAQDREREHE
LPREGARERAEGEKQQPNPASPEDLVDALGQPGRPVEAGQCGFSREELEQILQERNELKA
KVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVKKQRKKIKAKMLGTPEEAESSDDEDG
SWPLLSKNKEDDSPPPESRVQSFFGLWCRSEAEAPRAETGSTSPSERGGEEEAPQQPHVE
PVGTPQAPNS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]