dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|37520210|ref|NP_923587.1| (Gloeobacter violaceus PCC 7421)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein gll0641 [Gloeobacter violaceus PCC 7421]
Sequence length 485
Sequence
MNASLPAGASSAACTPFQKVLPTILKMVCLRSQAVRLVGFGLAATVALSAAPVQAQVGFA
PAQTFGVGTTPRGLAIGDLDGDGRIDIVTANIGNNTLSALLGGGDGTFGDLQNYPVGSSP
RAATLADLNGDGDLDAITANGGSGNLSVLRGNGDGTFAAAVNYPVNGTFPAAVAAGDLDG
DGDLDLVSTNRYSENISLLSNNGNGTFGAPRNLVLPPGPSSVVIVDLDEDSDPDLVVGNL
FSANVSVLLNNGNGTFAAPRNYAAASGTSAVGMGDLDGDGDLDLTAVNRFADNVSVMLGN
GNGTFGATRNFAVGDYPVALAIGDLDENGDLDLVTANRRDAGNVSVLPGNGSGGFTAALT
FATGGDGATGVEAGDFDGDGDLDLAVANGFASNVGVLINTGDGVVLPVIDSITPRRGPVG
TEVTITGTGFTGTTAVTFGGASAAFTVISGTQITAIVPAGATSGPIAVTTPAGTATSARR
FRVTS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]