dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|37521726|ref|NP_925103.1| (Gloeobacter violaceus PCC 7421)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein gvip296 [Gloeobacter violaceus PCC 7421]
Sequence length 125
Sequence
MDLKAITKATAKVLVSYLTYQAVRVVLDQLRETDPQRAIWFNQFSTAKTLQDGEAYLREL
VAVDPALAMRVMTVREHLAEQVADFLPELVRTGVQQSNMDHRRQYIERTLQLESPAESEA
ETPND

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]