dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|ChlNC64A_1|138760|IGS.gm_22_00001 (Chlorella variabilis sp. NC64A )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 898
Sequence
MLQPIAAAGAAALQGTATGPRAALFFSLTLLGIKSKQDFNAGMKVSYKNTLMRMAPGSTI
IPVAIEPDDTGQSIHTVALFPGSVAAGTVAAQQLAAKLRAGGLNAYFDQRKFRRVHAEVV
ADPYLADSTGDTIPSLPGSRPVAMITVKWYDLAPDQVTAQKRKAYVAAIQKLVPAALQKL
AMDTLMSNAAPTALAKALNTMRTRPASFGQMASDDGYAVRWVPDSSFVSPCDVHTTLTLA
GINVYAPSCTRQLVTAYLAALKTKLPSDVVTSVVSAMHVSSGCRVVTSSAYPGSQQGAAM
DLAGRKVPSNYPLNGTVFGAGSKTPAFFAEGAAATGQQRGMVTARHLLLDAAAYEYKLQP
VNCAPGKSCPTLTFTFATADAYFSGLSPGTTYNVTVEGISNTGQRTAGQNTLQFTTPASV
HLESAQATSSTTATATATTQPAGAFPQYMYSLRKLGCITCKSLNFPSSTATVNLHGLEPG
ATYNVTVEGISKTGQRTPGDNMLQLTMPAGLRLTQAKATGYTTGAATARALPSDAFTKFV
FTVTKARCTVPPCPTLAFTSRAPSNQLTGLEPGTKYNVTVLGVTKTGQRTKGANMMQLTT
YMFTVKKALCPGCPKLEFNSSTRMGTFTGLAPNTAYAVTVAGVDWSGRRTQGSNSLQFKT
PTKSAPPPPPTPTLKLTSARATTPTTAIATASPQPPGAFVKYNVTVAGMDKSGRKTQGIN
MLQFKTLDAHPHRLVWPSLVQFIFTVKKAACPSCPALHFTSNTTLGVFSGLTPNTTYQVT
VVGMDKTGRRTPGSNALHFKTPAGAFLRAPPSPPPVAPKSLMLISAHATSPTSGTATAQP
QPAGAFVKYIFTLQEVACPSCEPLAFSSTTSVGIFTGLKPNTKVSMCRVTAVDSGRQT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]