dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|337283010|ref|YP_004622481.1| (Streptococcus parasanguinis ATCC 15912)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sugar isomerase domain-containing protein AgaS [Streptococcus parasanguinis ATCC 15912]
Sequence length 389
Sequence
MLDYTKEDLQELGAEITSREIYQQPSVWKETARLYQERKAEIKAFLEKIGQEYDYIKVIL
TGAGTSAYVGDTLVPYLQEVHDERHWNFQSIATTDIVAHPQTYLKKEVPTVLVSFARSGN
SPESVATVQLAQDLVDELYQITITCAEEGKLAQQAHGDERNLLFLQPKETNDAGFAMTSS
FTSMLLTALLVFDPSEEEIKENRVSELVHLSEQILEKDREVKEVVDLDFERVIYLGAGPF
FGLAHEAQLKILELTAGKIATMYESPVGFRHGPKSLINDQTLVLVFGSIDPYTRQYDLDL
VREVAGDQIARQVVLLTDQVAGIEHVREVLVEASADSLDIYRAFPYIIYGQLISLLTSLK
VQNRPDTPSPTGTVNRVVQGVIIHSFHKE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]