dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|305663891|ref|YP_003860179.1| (Ignisphaera aggregans DSM 17230)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment replication factor C small subunit [Ignisphaera aggregans DSM 17230]
Sequence length 323
Sequence
MELLWAEKYRPKTLREIVNQEEIVNRLMKFVEEKNMPHLLFAGPPGTGKTTAALALAHDL
YGDEWRRYLLELNASDERGIAVIRSKVKEFARSKLPGDIPFKIVILDEADNMTADAQQAL
RRIMEMYVETTRFILIANYPSKIIDPIQSRCASFRFTPLKREDVTSRLRWICEQEKVKCD
EDGLDVIYELSGGDMRKAINILQSASALGEVTVSNVYKVVGLAHPKEVREIITLALSGKF
IEARDKLHNLMIVYGLSGVDIIKQMHREIFSADLKIPEDIRVILADYIGEIQFRIVEGAD
DEIQLSALLAKMALLGKKENIRI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]