dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|307545825|ref|YP_003898304.1| (Halomonas elongata DSM 2581)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment assimilatory nitrite reductase, NAD(P)H, large subunit [Halomonas elongata DSM 2581]
Sequence length 834
Sequence
MKASNSAPQDLIIVGNGMVGHHLVEQLVERDAHRHYRIRVFGEERHLAYDRVHLSEYFSG
RDADDLALSTADYYAEHGIELHLHEAVTDIDRDARELVTPQGRYAYDRLVLATGSYPFVP
PIPGGDRDGCLVYRTLDDLDAIREAARSATTGVVVGGGLLGLEAANALRGLDLDTAVVEF
APRLMPMQVDNEGGELLREKIEALGVQVLTDRATQHIEDGDTSRHRMVFQDDKLLETDLI
VFSAGIRPRDELARNAGLEMGERGGVVIDDRCLTSDPAILAVGEVALWRGSIFGLVAPGY
QMAKAAADTLSGGELTFEGADMSTKLKLLGVDVGAIGDAHGDRSPGARQFRYCDQIKQEY
RKLVVSSDGKKLLGAMLVGDNATYDTLMQYYANGLELPEDPASLILPNVEGAPTLGPDAL
PDTASICSCHNVTKGAICEAIDAGCNDLGAVKGATKASTGCGGCAALLKSVVDSELEARG
VEVDQSICEHFAHTRQELYSIVRIEGIKTFGELIEKHGHGLGCDICKPAVASILASCFNE
PITDAAHVPLQDTNDTFMANMQKNGTYSVVPRVPGGEITPDKLIVLGQVGEKYGLYTKVT
GGQRIDLFGARLEDLPSIWGELLEAGFETGHAYAKSLRTVKSCVGSTWCRYGVQDSVGMA
IRLENRYKGLRSPHKLKLAVSGCTRECAEAQSKDVGVIATEHGWNLYVCGNGGMRPRHAE
LFATDLDDDTLIRYIDRFLMFYVRTADRLQRTSVWRENLEGGLDYLKEIVIDDSLGLGDE
LERQMQTVIDNYECEWAGALSDPEKLKRFRSFVNDERPDPDIIVTEERGQLRPA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]