dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|307546404|ref|YP_003898883.1| (Halomonas elongata DSM 2581)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment thioredoxin reductase [Halomonas elongata DSM 2581]
Sequence length 316
Sequence
MSEARHERLIILGSGPAGYTAAVYAARANLKPLLITGIQAGGQLTTTTDVDNWPGDDIGV
QGPELMERMKRHAERFETEVLFDHVHEVELRERPFTLKGDNGTYTCDALIIATGASARYL
GLESESRFMGQGVSACATCDGFFYRNQDVVVVGGGNTAVEEALYLSNIASKVTLVHRRDS
LRAEKILQDKLFDKVENGNIEVIWNHTLDEVLGDNTGVTGARLKSTEDGSTRELDAPGVF
IAIGHSPNTGIFEGQLDMAGGYIKVQSGLEGNATATSVPGVFAAGDVMDHVYRQAVTSAG
SGCMAALDAERYLDEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]