dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|320157719|ref|YP_004190098.1| (Vibrio vulnificus MO6-24/O)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4-like protein) [Vibrio vulnificus MO6-24/O]
Sequence length 130
Sequence
MTMSSPNEAVRLDKWLWAARFYKTRSIARDMVDGGKVHYNGQRAKPSKIVEVGAVLKLRQ
GNEEKTVVIEKLSTQRRGAPEAQTLYSETQESQAKREAQAMQRKLNAHNPSPDRRPDKKQ
RRDIIKFKHQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]