dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HCAG_05866T0 (Histoplasma capsulatum class NAmI strain WU24 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | HCAG_05866 | Histoplasma capsulatum NAm1 DUF21 domain-containing protein (736 aa)
Sequence length 735
Sequence
MYPNQHVAGRSLALAVGKLLFLAIAQFPTTYAFPILGSLQLRDQEHGNPSDDPRLWLYLS
VAAALVISGGAFAGLTIALMGQDEVYLQVIKTSGEGAEKKHAEKVLNLLKRGKHWVLVTL
LLSNVITNETLPIILDRSLGGGWPAVLGSTALIVIFGEVVPQSICVRYGLPIGAWMAPCV
LVLMYIMSPVAWPIAKLLDRILGEDHGTIYKKAGLKTLVTLHKNLGQAGEQLNSDEVTII
TAVLDLKEKSVGSIMIPMEDVFTMSADTVLDEKMMDLILSQGYSRIPIHSPDEPHNFVGM
LLVKMLITYDPEDCKLVRDFALATLPETRAETSCLDIVNFFQEGKSHMVLVSEYPGEDHG
ALGVVTLEDVIEELIGEEIIDESDVFVDVHKAIRRMAPAPKSRVPKGQIVSEPTPTHGSL
IDVSDNNVTNQEPTRSETLARSHSVADYGSPPQTTFYFRKHNTFDSTDSVDSPITMRGPT
PEIREHLKHLGPSNLASRPRQTRYQTVKIKPGEVTSSDRQSSVSQSRPSEHLSAVPTRPQ
SQVRSAGKSASDAVLAVQTYGTMGRTTQSPTAEMMEEISTHRGSPRHDRSRNLTTSKNEA
SVVSRSPSTRSHRNRPSSAGSGAQKTREPHRRHGPARSGSITEQIVDSNGIRKVILQTSS
DATTDEDGGVGTSPGADQAQTTQALTSSSGNATPPANGSSGTHGEKKKRRRKRRWGAGTK
STDQGNRDETQHLLE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]