dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|347523660|ref|YP_004781230.1| (Pyrolobus fumarii 1A)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment nitrogen regulatory protein P-II [Pyrolobus fumarii 1A]
Sequence length 119
Sequence
MTKLIIAFIRPEKLEDVKKELEAIGVYPMTIVEVRGRGEQRGITLMYRGHPVRVDLIPKL
QLEIIVEDDMVDKVIEAIVRGAYTGRPGDGRIIVLPVEKNIRIREEYEKLRTREQPPTP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]