dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSP00000433873 (Homo sapiens 76_38)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known chromosome:GRCh38:11:105933808:105974430:1 gene:ENSG00000152578 transcript:ENST00000525942 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence length 104
Sequence
XVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKNSCKPCRFETQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]