dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

vb|PHUM051710-PA|EEB10614.1|conserved (Pediculus humanus corporis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein|DS235022.1:81690:94380:-1|gene:PHUM051710
Sequence length 1472
Sequence
MSVFENEGTAVCLNTSEVSDQVLSEVDEDMSGAERDLAEDAQWKRIQQNTFTRWANEHLK
TVNKHIQNLETDLSDGLNLITLVEVLAGRKLPKHNKKPNFRSQKLENVSVALKFLEEDEA
IKIVNIDSTDIIDCKLKLILGLIWTLILHYSISMPVWDGEDDLTNGEKGATPKQRLLHWI
QSKVNDLPIGNFTTDWNDGKAVGALVDSVAPGLCPDWEDWDPKNSLNNATEAMNLADDWL
NVRQLIKPEELVNPNVDELSMMTYLSQYPNAKLKSGAPLRPKSDPHRVRAYGPGIEPRGN
VVGTPCNFTVETFSAGKGNVEVMVINSQGQQEPVNIKYNNDRNMTYSVFYIPQMEGNYKI
FVKYAGKDISKSPFQVFVEDGPGDASKVTAFGPGLEPEGNVANRTLHFDISTKDAKKGVP
EVIILDSAGVKSTVPAKVWQVSPELWRCEYTPHSVGLHSINILFAGQPIPHSPYGVRISP
VSDAKKVRVTGRGVQATGVRVQDVADFKIHMEKAGEGTPEVRVIGPGGVNEPVKIQKLDK
FTYEAAYKPRKEGRHVVMITLAEQEIPRSPFEVNVGPYKETNIKAYGPGLSGGVVGCPAL
FTVETNGETGALGFSIEGPSQAKINCKDNGDGSADVCYFPTAPGEYAVHILCDNEDIPKS
PYMSNILPAENFYPDKVECSGQGLQENGLISGQKTNFKIDTRKAGKAPLDVEILDKKGVP
IDSFITENNDGTYTCTYTPTDSKHTIQVNYGGVAVKNSPFRINVGEATFIDRIRIYGPGV
EKNVKSNNPTHFTVDCKEAGAGDLRLFMVNENKSEVPLKVTDVGNKIYVVEYYPSLPGIH
TLTAYYGNAPILPNPLKIPVSPHVDPSAIRVDDFNKSKIYLLLIFFFFLKFKRDIIEPCD
HYLVNILYLKKLIIIRRLLACVRASGLGLSRGLVRYPAEFIIDTRGAGQGSLGVTVEGPC
EAAINCRDNGDGTCSVAYLPTESGDYVVNITFNNEHIQGSPFQAIILSDDDIKDIEVSGN
GIQYEGVYVDSPTNFIIDSRAVNCQTDGKVTCNIMNPSGKKTENVISPMMDGIYKVSYTP
FEEGVHTIDILYDGIPISGSPFLVNVQRECSPKKCRAYGPGLQKGAGTGGLGLTIEGPSE
AKVTCKDNRDGSCTVEYVPTEPGDYDVSIKFSDQHITGSPFSVSNQVIAGVKFLPLLPLM
RLKQGKLLSGLIYPQLMVIIIIIIIIFFCPLKSEIKDNEDGTFTVFYVPPAEGANISARV
TYDHKDIPNSPFYLNVLPTVETDKVKLRGPGISNKGIPASVPTDFTIDVSDAGYGDLQVQ
VLGPDGYQKKVKILEEGNGIFKATYTPDDCGKYKINVKYGGMDLPVSPVNVQAVATGNAE
KCQIVEGIQRNLTSGEEYCITVNAKNAGYGAVTCKIRSSSGSDLDIDIEDNGDGTFKIYY
TVQDAGEYTISIKFGGQPIPDGFYSFTLLEVT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]