dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

vb|PHUM297900-PA|EEB14392.1|5-aminolevulinate (Pediculus humanus corporis )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment synthase, nonspecific, putative|DS235283.1:371486:373890:1|gene:PHUM297900
Sequence length 542
Sequence
MSCPFLNCFSKTFVKRYGTILSANFEKYCPVVGSYYCTLPSEKKVEKNPVQKCPFLANST
QSKIIKEANEECQEDLILKKKEISIKSSFDYEQFFHSQILKKKQDHSYRVFKKVNRLAQS
FPSALEYTGKKKTVTVWCSNDYLGMSRHPQVIAAVKKALENHGTGAGGTRNISGNSLFHE
NLEEEISRLHQKESALLFTSCFVANDSTLFTLAKALPGCHVFSDAGNHASMIQGIRNSRV
PKHIYRHNDADHLNEMLSTVDREIPKIVAFETVHSMTGAVCPLKKLCDVSHKHGALVFVD
EVHAVGLYGEHGAGIGERDNQLNNMDIISGTLGKAFGNIGGYIAGSKHLIDMIRSYAAGF
IFTTSLPPAVLAGARESIKILRSYEGAVLREMHQQNVRLLRNKLQEAGLPLEHTPSHIIP
IRLGNAEKCTLVSDILLRDYGHYVQAINYPTVPVGQEKLRLAPTPFHTKQMIEILVRDMI
SVFKKLNIPTFSNNNICPNECSYCKKPLLFKKQESKINNYSNLNNCCELPNCPQIQKIPA
SI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]