dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

14.m00270 (Tetrahymena thermophila SB210 1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cation channel family protein
Sequence length 1126
Sequence
MSQDRGVSYLNNLNYRENILLNEEDHKFFQAFPYKQRDSEVQSVSYSQTSRRDLSANNEE
KIQENTQDNTILQAIDEAQRQQYHSVLQQQENSIKYFQKQTLKKLQTQKLVIINTDVNIK
DLAYKNEQTSKLMNILKLLVNIQHFFRILSMNSRIFNKLTQHQHYLISDISSSYTKNFNL
KKGNNKFNIFNNSLYFLIDLIHKLDKYVFTPQNNLIKAWDTLQSLLIIFSTFLLNLELFF
GMNISNFQLLFQVIFIVSIIDILVGFNTGVLKKGNIITERNFIIKSYIKNRLFFSLIGNI
PLFFYISKVEVSTTMRILVNIFYAFKWNKVSDVLKQIAFYVSYEKDHKNIFDLLKLLIFV
IGICHIFCLFWHGLVMFEINNGITNNWLESKNLLNASIQERYIYSFYFLAVTMATVGYGD
ISPQNQFEVLFTTVTIFVTCIVYAFSLNTIGAIIENIEKKDKKYKENLQIIHALMREEEV
SRNLKIKISDYIKYLYKESNEIQRKQEKLIIEKLSAKLRNDLNLEIQGKYLSNIPLFKYF
KEKDKVAKIMEEQLYSPSEIIFTQGDIDDCSLYYIVKGSVSIIFESGQNLNREAIQIELK
QNKQYFGEISFITGNPRTYTAKATDFCKIFKINRQSFLSVIKEHDQDYENFQMIKEAITF
NYYFQIQQQLTTRKSFIQQETYQEKLFTKKNAVLQINNVESLSEIIDFIENGSYYQDQFD
NEANYKQEIQLGSERGIRLRNNTHSSNFISTKNDNFGSQLDTIRKAQKSMENQQEKTIDY
LKIQRKSYLNQQNNQQLNVDQNNQTQKQTKKSFLYSASQNQQFIQELQKCEQVDIKQNSS
MNNDELQPQSQPSISSLTSQNERNDSIDSSLSIENKIENNPKQKKSFLIPNYLEDKQNQN
QITFEQKDEQLLQKRLSQISQRRQSNKNKTIKLINNSSKNIILNNDDQQLQYNRYFVDKQ
KNNNQQNDRSINLILLAKEPNQLENNQTTIQFNTSKITEGQITKFNNFQIPAELLTLKQF
QQLSSNYSLQNLSQLSLKNSQNQYSLQNEQKVNQGTNSQSSGQFSKHNQIGILQSDKKID
DITESSDQVNYLMLQIFDKAKIYKYYQPHFNYTEIQNIYLSFLKKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]