dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

217.m00053 (Tetrahymena thermophila SB210 1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cation channel family protein
Sequence length 1751
Sequence
MDYLETEKDRLETYQSQNDQANLRKQDQLNRKYKLRIKCDSQENSFNEMNIVQSPNQAQS
HNNMSEQNKSNCIKKIQDSVIFQDKKESENANNSMKIQGNNENKLDVYQSSYFDPQKEVY
ISTNQRKYNHPNQNGASHQVPFKRKLTRKSEIFQSQVLNPQDISTKDSEQVIKSQKNFPK
KKQGPNQFSLYFKTLKAVRQFKLFLIPKSINIRSSKIINDASHYVETNKAQTAFNPFEIM
EKISKSNYNLKNFFRELKSVFSDTKVKICKFLDENITVLDPNGYFKMIFDIMMIFAIIVC
IFFNTVEIFFAIDFYDLYEYGYPILDYFLLILFILDIILNLNTGVFNEGQISKDRVEIFN
SYYDGRLLHDTLSLLCFIRQRNHQIVTSFFDLFVFFKIGQVSLKLQQYQQTAAHCVAVIF
YGQVIFAEWISFDDAHNWVEASTVVTRSDSWLKIYIFSLYFSVTTMTTVGFGDITPKNGH
EAVIVIISMIIACGVFAYTFNLIGSIVSEMNRRQEEFKIRMKKVYTYLSNRNVDQDLKYQ
VLKFLEFKYNNENTLSQEEEEGILDGLSDNLIYQINYQSKFKILNNGFELFKSFSKEIKD
ELCMKLKIIRGNKEEIIFEQDTIQDDPQMYFIHQGSIEIFFKNKQTKNNKESILNVLKEG
QFFGELSFFTDKPRSAGARVKSSCILFSLSKSDFLSVLQNDIFELEKYHLLNSKLQFSES
NQQISQQCYYCSKETHIIKRCPHLHYNPDNHLIILKNNFSVTSVERKNWVRNREKSRAFE
IMLEVTDLVSYMKKKNKSECQLYSDQGSSDEYITFEDQDSSSQDQLMYSNHHREIIQKLR
KMYNNQEITVSDQNSNSNSQSESEQKPSKRDSQDKLSKTNSNKIIDNNDGKISNVEQKSE
NQIKDELLSPPIYLNKHFLNVEKQHSKQQRHSLQLSQNQNSQHNRLKKYQTSNLTQIYHN
IYPKINIQDDEDNLQVESDSSSQQNDSKQDKKNQKQIENQSQSSNQISLRNGQQSYSPSL
RIEKAEQNQNKPYRESFFQNFKENENKSIFNCKDSANLIQLQPNQFGQQQFNAGFQSNLE
IQQQLQNSDIGSQQTNNLEKQLLSNQGINSLEQQQIQNANQLNIQEQNQTNNVQIINLQH
QQINNLEKSQQSNLLQEQQLNKEDNQQQNVSHQQLRSDNEQFNLLQQHQNNENIYNNLQQ
NPFEDQNILYQQEQKQQNNSVNGKIQIQKQTQKENEVFQDSEIEELIEENDVNIELKQPD
SMEEFQSKNIGNLQERSKTAWIAENQIKNNSQMPKKDLKSFQRRSIQNHIESHRKSKMLS
LQQSLEVYVQQSLLGGAHKRNMSSQNQSLHQRELSQNKSSLIQLTNNKKRTLRFSNVETF
ISVPDEVPFSTPIDNVKNPFNQKQAQIHYIGQPSPSTVCYMPSSFSSSQPLKQKIEANLQ
INDQIIENEQQQEQSKYQALNKLKSKETNKIQHEPPQIEEEPVQQELHKEVKKLARKDKR
TKTHNEQNGMMHKFQAREQQNEHSDDNRKKAESSKRDKFKKRTALIPLQNGRLNPLRTLG
LFREQKNKAHNIIPQSPYSIATSQSPNRLNPSKPELNSIKDKSLQERENLQGSQMRLSTF
KFNQTTDQNSIQNYQQQKEGEDQINRDSIKKQIQMQRQQTVQLQPDLMDEVKIVQNDTLI
FDKMKEYKNYFPSFNFKTILTTYNKLKNIQNNKLPSYFNVYSFYNRFDYKKIYKQKPVNN
SVLKRSVANAQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]