dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Smp_055600 (Schistosoma mansoni )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ||29190.m000341, 29190.t000016|lin-7-like proteins|Schistosoma mansoni|chr unknown01|||Auto
Sequence length 193
Sequence
MAESLSLQRDINRVLELLEILQRCPEIQPSKLAALQRILQSDFCDMIREVYEHIYTTVDI
NGSEEVKASATAKATVAAFAASEGHAHPRVIELPKTNEGLGFNVMGGKEQNSPIYISRII
PGGVADRHGGLKRGDQLLSVNGISVESEHHERAVELLKLAQGTVKLVVRYTPRILEEMEA
RFDKQKARRRQLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]