dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSCSAVP00000019103 (Ciona savignyi 69_2.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel reftig:CSAV2.0:reftig_16:3258373:3261775:-1 gene:ENSCSAVG00000011216 transcript:ENSCSAVT00000019310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 240
Sequence
METGELSEEMQDPTTSINIIYDRCGLCGNIGKALACLYCMQSDSKRFLVLTTPTKSLRSL
NFQGKYMYLSRDIQDKIQNVHQVLSQHEQLIISSSNSVEELAIQASLKFKIAHCSQNVAR
LKKLLLARKLEMKQQQNLLLDNKRVIMTLRKKIGKVSQKKSKMKEYIRNRQDSILAIRKK
EQILREDLQIHRLKHISMLVQYIFPIEECNKSDLPNMVPQVHDDHGSEVDRETALLQEEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]