dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|315502939|ref|YP_004081826.1| (Micromonospora sp. L5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment catalase [Micromonospora sp. L5]
Sequence length 753
Sequence
MESSKPTQIVKGVVEAAVEKVGDALTPDVPGAPGSAPPPLEEPTTPHGPLPPKDEQGAPD
TRTPTGAETGVPKIAKGQQGAYLTTANGARLRDTDHSLKAGPRGPVLLQDHHLREKITHF
DHERIPERVVHARGAGAHGTFVAYGTAEEVTRAGFLKKGRETPVFVRFSTVLGSRGSADT
VRDTRGFATKFYTDEGTFDLVANNIPVFFIQDAIKFPDVIHAGKPHPDREIPQAQSAHDT
FWDFVSLHTEAQHHTIWNMSDRGIPRSYRTMEGFGVHTFRMVDEAGATVLVKFHWKPKLG
VHSLTWEEAQLIGGIDPDYHRRDLYDAIEAGAYPEWELGIQVFPDTPEETFAGIDLLDPT
KIVPEELAPVQPIGKLTLNKTPRNFFAETEQVAFHVGHLPPGIDVTNDPLLQGRLFSYVD
TQLTRLGGPNFTQIPINRPHADVNDMLRDGFHQHAVHAGVAPYRPNSLDGGNPFPAGDRE
HAFVDTPVTVAEAPKVRAAPASFDDHYSQVRLFWQSMSPVEKEHIIRAYTFELGKCYHQA
IKERQLQCLANVDPVLCEQVAIGLGLPVPQPTVPQAEVQPSPALSQVGREWPADGRMVGI
VVDAQADLGDVHEVRREVFAAGMVPLLIAAHGGTVDGLPVQRTFATGRSVEFDAVLLAGA
PAPAPDALPARDAKAGAPGSPTVDPRVLLLVEEAWRHAKVIGAWGAGAEVLHQAGVTGTP
GVVTGGSGTEVLGEVQRLMAAHRVWERFPASVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]