dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|332157734|ref|YP_004423013.1| (Pyrococcus sp. NA2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein PNA2_0091 [Pyrococcus sp. NA2]
Sequence length 127
Sequence
MVEVEHWNTLRLKIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGKKSRIHS
SDVIRLSTDLPIVIEVVDRGHNIERAVNAIRPMIKDGMITVEPTIVLWMGAEEEIKKFEE
DAVAERR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]