dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|384261913|ref|YP_005417099.1| (Rhodospirillum photometricum DSM 122)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment diaminopimelate decarboxylase [Rhodospirillum photometricum DSM 122]
Sequence length 422
Sequence
MDHFTYKSGILHAEDVPLPRIAESVGTPFYVYSSATLEHHYRVITEAFTGQDAHVCFATK
TNGNKAVLTLLGRLGAGADVVSVGEMRHAIAAGIPAKRVVFSGVGKTRDELTAALSLGIA
QINVESEPELRALSEFASAMGTLAPVALRINPDVTADTHDKISTGRKENKFGIDWATAPA
LFRLANTLPGIDLKGVAVHIGSQILDLAPFRAAFLRLRELVLSLRGEGIALKRVDLGGGL
GVPYHRDDPSSPAPSAYAALAKECFGDLGVTLILEPGRLIAGNAGLLVSRVVYVKEGAAR
KFLILDAGFNDLVRPAMYDAYHEILPVEQPAPDAPYEPLDVVGPICETGDLFARQRPLPP
LAPDALVAFATAGAYGAAMSSTYNGRPLVPEVLVKGNRFDVVRRRPTLAEMTALESVPEW
LK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]